Maple LL-37 is the only cathelicidin-derived antimicrobial peptide produced in the human body, and it has become one of the most intensively studied host defense peptides in preclinical research. A 37-amino acid peptide cleaved from the C-terminal end of the human cathelicidin protein hCAP-18, LL-37 research spans antimicrobial defense, biofilm disruption, immunomodulation, and wound repair pathways. For researchers investigating innate immunity and peptide-based antimicrobial strategies, LL-37 represents a uniquely multifunctional molecule with a growing body of preclinical evidence.
This article reviews the current research landscape for LL-37, including its structural pharmacology, antimicrobial and anti-biofilm mechanisms, immunomodulatory signaling, and preclinical wound healing data. All findings discussed are derived from in-vitro and animal model studies.
LL-37 Structure and Biophysical Properties
LL-37 is a 37-residue, alpha-helical peptide with the sequence [LL-37, 37 aa] It carries a net positive charge of +6 at physiological pH, which is critical to its interaction with negatively charged bacterial membranes. The amphipathic helical structure allows LL-37 to insert into lipid bilayers, a property central to its antimicrobial mechanism.
Crystallographic studies published in Scientific Reports (2020) revealed that LL-37 forms a narrow tetrameric channel structure in the presence of membrane mimics, with a strongly charged core capable of disrupting membrane integrity. NMR structural analysis in dodecylphosphocholine micelles confirmed the alpha-helical conformation spanning residues 2 through 31, with a flexible C-terminal tail.
Antimicrobial Mechanisms: Direct Membrane Disruption
LL-37 exhibits broad-spectrum antimicrobial activity through multiple mechanisms. Research has documented activity against over 38 bacterial species, 16 fungal species, and 16 viral targets. The primary mechanism involves electrostatic attraction to negatively charged lipopolysaccharide (LPS) in Gram-negative bacteria or lipoteichoic acid in Gram-positive bacteria, followed by membrane permeabilization and cell lysis.
Time-lapse microscopy studies of E. coli treated with LL-37 revealed a sequential process: initial discontinuities in the outer membrane, followed by progressive cell wall damage, and ultimately cell death. This multi-step membrane disruption distinguishes LL-37 from conventional antibiotics that target specific intracellular processes, and it contributes to the low resistance development observed in preclinical models.
MIC Values Across Bacterial Species
Minimum inhibitory concentration (MIC) data from multiple studies provides quantitative benchmarks for LL-37 antimicrobial potency. Against planktonic Staphylococcus aureus, MIC values range from 0.62 to 32 μM depending on strain and assay conditions. Against Pseudomonas aeruginosa, a key opportunistic pathogen, the reported MIC is 64 μg/mL. Notably, LL-37 retains activity against methicillin-resistant S. aureus (MRSA), with MIC values of 132.3 mg/L reported for biofilm-forming MRSA strains in a study published in Microbial Pathogenesis (2021).
Anti-Biofilm Activity: Sub-MIC Efficacy
One of the most significant research findings for LL-37 is its potent anti-biofilm activity at concentrations far below its MIC. A landmark study published in Infection and Immunity (2008) demonstrated that LL-37 inhibited P. aeruginosa biofilm formation at concentrations as low as 0.5 μg/mL, well below the concentration required to kill planktonic bacteria. This sub-inhibitory anti-biofilm effect operates through interference with bacterial quorum sensing and attachment mechanisms rather than direct killing.
Against S. aureus biofilms, research published in PLOS ONE (2019) showed that LL-37 at 0.16 μM significantly impaired bacterial adhesion and prevented biofilm formation. At higher concentrations, LL-37 demonstrated bactericidal activity against established 24-hour S. aureus biofilms, outperforming both silver nanoparticles and conventional antibiotics. At concentrations of 1000 μM, conventional antibiotics achieved less than 1 log reduction in colony counts, while LL-37 showed substantially greater biofilm disruption.
Immunomodulatory Functions Beyond Direct Killing
Beyond its direct antimicrobial activity, LL-37 functions as a potent immunomodulatory peptide. Research has identified several key immunomodulatory mechanisms:
Endotoxin neutralization: LL-37 binds and neutralizes bacterial lipopolysaccharide (LPS), reducing the inflammatory cascade triggered by Gram-negative bacterial infections. This LPS-binding capacity is particularly relevant for research into endotoxin contamination control in laboratory settings.
Chemotactic activity: LL-37 promotes the chemotaxis of neutrophils, monocytes, and T cells to sites of infection, coordinating the innate immune response.
Cytokine modulation: The peptide modulates production of both pro-inflammatory and anti-inflammatory cytokines, helping to balance the immune response between pathogen clearance and tissue damage prevention.
Preclinical Wound Healing Evidence
LL-37 has demonstrated significant wound healing activity in multiple preclinical models, primarily through angiogenic and cell proliferative mechanisms.
Angiogenesis and VEGF Upregulation
A study published in the Journal of Clinical Investigation established LL-37 as an angiogenic factor, demonstrating that the peptide promotes endothelial cell migration, tube formation, and VEGF-mediated signaling. In wound tissue models, LL-37 treatment increased expression of hypoxia-inducible factor-1α (HIF-1α) and vascular endothelial growth factor-A (VEGF-A) at both mRNA and protein levels, accelerating neovascularization. A 2025 study in Frontiers in Pharmacology confirmed these findings and proposed LL-37 as a potential therapeutic strategy for ischemic tissue recovery based on its angiogenic properties.
Hydrogel Delivery System Data
In-vitro studies using LL-37 in a keratose/kerateine hydrogel (25:75 ratio) showed fibroblast proliferation reaching approximately 85% by day 7, cell adhesion of approximately 90 cells per high-power field, and scratch closure of 73% after 12 hours with complete closure by 24 hours. In vivo assessment of this formulation demonstrated wound closure exceeding 98% at day 21 and microvessel density greater than 30 vessels per high-power field at day 14, significantly superior to control groups (ACS Applied Bio Materials, 2023).
A separate study using LL-37 in chitosan hydrogel for pressure ulcers showed wound area reduction to 84.24% ± 0.25% on day 11, 56.22% ± 3.91% on day 13, and 48.12% ± 0.28% on day 15, significantly outperforming untreated controls (Military Medical Research, 2020).
Challenges in LL-37 Research
Several factors complicate LL-37 research applications. The peptide has limited proteolytic stability in biological environments, with serum proteases rapidly degrading the full-length sequence. Cytotoxicity at higher concentrations has been observed in some cell lines, requiring careful dose optimization in experimental protocols. Production costs remain elevated due to the 37-residue length and complex folding requirements.
These challenges have driven research into truncated analogs and modified derivatives that preserve or improve biological activity while reducing toxicity and increasing proteolytic resistance. Nanoscale delivery systems are also under active investigation for targeted delivery and extended peptide half-life.
Key Research Findings
- LL-37 is the sole human cathelicidin antimicrobial peptide, active against 38+ bacterial species, 16 fungal species, and 16 viral targets
- Anti-biofilm activity occurs at sub-MIC concentrations (0.5 μg/mL against P. aeruginosa), operating through quorum sensing interference
- MIC against planktonic S. aureus ranges from 0.62 to 32 μM; retains activity against MRSA strains
- Wound healing models show >98% closure at day 21 and >30 vessels/HPF microvessel density at day 14 in hydrogel delivery systems
- LL-37 upregulates HIF-1α and VEGF-A expression, promoting angiogenesis in preclinical models
- Pressure ulcer models show wound area reduction to 48.12% ± 0.28% by day 15 with LL-37/chitosan hydrogel treatment
- Tetrameric channel formation confirmed by crystallography, explaining membrane disruption mechanism
Research Applications and Quality Considerations
For researchers working with LL-37, peptide purity is particularly critical given the molecule’s sensitivity to degradation and its use in antimicrobial assays where impurities could confound results. Third-party COA verification confirming HPLC purity and mass spectrometry identity is essential for reproducible experimental outcomes.
Maple Research Labs provides independently verified research peptides with third-party COA testing by Janoshik Analytical. Researchers sourcing LL-37 for antimicrobial, immunological, or wound healing studies should verify peptide identity by molecular weight (4493.33 Da) and confirm purity exceeds 98% for sensitive bioassays.
For researchers previously sourcing from US suppliers affected by recent market disruptions, Canadian-manufactured peptides with domestic shipping eliminate cross-border delays and customs uncertainty. Browse the full research peptide catalog or review the complete product offering.
For research purposes only. Not for human consumption. Not for diagnostic or therapeutic use.